-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against 14-3-3 epsilon was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against 14-3-3 epsilon was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09103A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 14-3-3 epsilon |
| Target Synonyms | MDS; HEL2; MDCR; KCIP-1; 14-3-3E; 14-3-3 epsilon | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, 293T, Mouse brain, Mouse lung, Rat kidney, Rat lung, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL | Uniprot ID | P62258 |
Uniprot Id
P62258
Target Species
Human
Target Name
YWHAE
Target Full Name
14-3-3 protein epsilon
Target Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Positively regulates phosphorylated protein HSF1 nuclear export to the cytoplasm.
Target Subcellular Location
Nucleus. Cytoplasm. Melanosome.
Target Protein Families
14-3-3 family
Target Synonyms
14 3 3 E; 14 3 3 epsilon; 14 3 3E; 14-3-3 protein epsilon; 14-3-3E; 1433E_HUMAN; Epididymis luminal protein 2; FLJ45465; FLJ53559; HEL2; KCIP 1; KCIP1; MDCR; MDS; Mitochondrial import stimulation factor L subunit ; Protein kinase C inhibitor protein1 ; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; epsilon; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; epsilon polypeptide; Tyrosine 3/tryptophan 5 monooxygenase activation protein epsilon polypeptide; YWHAE
Target Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene.
Notification