-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1520-1690 of human CHD4 (NP_001264.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CHD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1520-1690 of human CHD4 (NP_001264.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09193A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHD4 |
| Target Synonyms | CHD-4; Mi-2b; SIHIWES; Mi2-BETA; CHD4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HT-1080, Jurkat | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1520-1690 of human CHD4 (NP_001264.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKK | Uniprot ID | Q14839 |
Uniprot Id
Q14839
Target Species
Human
Target Name
CHD4
Target Full Name
Chromodomain-helicase-DNA-binding protein 4
Target Function
Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones.
Target Involvement
Sifrim-Hitz-Weiss syndrome (SIHIWES)
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
SNF2/RAD54 helicase family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ATP dependent helicase CHD4; ATP-dependent helicase CHD4; CHD 4; CHD-4; CHD4; CHD4_HUMAN; Chromodomain helicase DNA binding protein 4; Chromodomain-helicase-DNA-binding protein 4; Mi 2 autoantigen 218 kDa protein; Mi 2b; Mi-2 autoantigen 218 kDa protein; Mi2 beta; Mi2-beta
Target Background
The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification