-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAPN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CAPN3 (NP_775111.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CAPN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CAPN3 (NP_775111.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09234A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAPN3 |
| Target Synonyms | p94; CANP3; LGMD2; nCL-1; CANPL3; LGMD2A; LGMDD4; LGMDR1; CAPN3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CAPN3 (NP_775111.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIA | Uniprot ID | P20807 |
Uniprot Id
P20807
Target Species
Human
Target Name
CAPN3
Target Full Name
Calpain-3
Target Function
Calcium-regulated non-lysosomal thiol-protease. Proteolytically cleaves CTBP1 at 'His-409'. Mediates, with UTP25, the proteasome-independent degradation of p53/TP53.
Target Involvement
Limb-girdle muscular dystrophy 2A (LGMD2A)
Target Subcellular Location
Cytoplasm. Nucleus, nucleolus.
Target Protein Families
Peptidase C2 family
Target Tissue Specificity
Isoform I is skeletal muscle specific.
Target Research Area
Cell Biology
Target Synonyms
Calcium-activated neutral proteinase 3; calpain 3, (p94); Calpain L3; Calpain large polypeptide L3 ; Calpain p94; calpain p94, large [catalytic] subunit; calpain, large polypeptide L3; Calpain-3; CAN3_HUMAN; CANP 3; CANP3; CANPL3; CAPN3; LGMD 2A; LGMD2; LGMD2A; Lp82; Lp85; MGC10767; MGC11121; MGC14344; MGC4403; Muscle-specific calcium-activated neutral protease 3; muscle-specific calcium-activated neutral protease 3 large subunit; nCL-1; New calpain 1; p94
Target Background
Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed.
Notification