-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APOC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human APOC1 (NP_001636.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against APOC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human APOC1 (NP_001636.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-09667A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APOC1 |
| Target Synonyms | Apo-CI; ApoC-I; apo-CIB; apoC-IB; APOC1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human APOC1 (NP_001636.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | Uniprot ID | P02654 |
Uniprot Id
P02654
Target Species
Human
Target Name
APOC1
Target Full Name
Apolipoprotein C-I
Target Function
Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
Target Subcellular Location
Secreted.
Target Protein Families
Apolipoprotein C1 family
Target Tissue Specificity
Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen.
Target Research Area
Cardiovascular
Target Synonyms
APO C1; Apo CI; Apo-CIB; Apo-CIB'; APOC 1; ApoC I; ApoC-IB; ApoC-IB'; APOC1; APOC1_HUMAN; APOC1B; Apolipoprotein C I; Apolipoprotein C I variant I; Apolipoprotein C-I; Apolipoprotein C1; Apolipoprotein CI; ApolipoproteinC I; ApolipoproteinCI; Truncated apolipoprotein C-I
Target Background
This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Notification