Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HBE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human HBE1 (NP_005321.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HBE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human HBE1 (NP_005321.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09781A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HBE1 |
| Target Synonyms | HBE; HBE1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human HBE1 (NP_005321.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH | Uniprot ID | P02100 |
Uniprot Id
P02100
Target Species
Human
Target Name
HBE1
Target Full Name
Hemoglobin subunit epsilon
Target Function
The epsilon chain is a beta-type chain of early mammalian embryonic hemoglobin.
Target Protein Families
Globin family
Target Tissue Specificity
Red blood cells.
Target Synonyms
Epsilon-globin; HBE_HUMAN; HBE1; Hemoglobin epsilon chain; Hemoglobin subunit epsilon
Target Background
The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with two zeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together with two alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal, and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5'-epsilon - G-gamma - A-gamma - delta - beta-3'
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
