-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNAT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human GNAT3 (NP_001095856.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GNAT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human GNAT3 (NP_001095856.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10026A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNAT3 |
| Target Synonyms | GDCA; HG1E; GNAT3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human GNAT3 (NP_001095856.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GYSEQECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRL | Uniprot ID | A8MTJ3 |
Uniprot Id
A8MTJ3
Target Species
Human
Target Name
GNAT3
Target Full Name
Guanine nucleotide-binding protein G(t) subunit alpha-3
Target Function
Guanine nucleotide-binding protein (G protein) alpha subunit playing a prominent role in bitter and sweet taste transduction as well as in umami (monosodium glutamate, monopotassium glutamate, and inosine monophosphate) taste transduction. Transduction by this alpha subunit involves coupling of specific cell-surface receptors with a cGMP-phosphodiesterase; Activation of phosphodiesterase lowers intracellular levels of cAMP and cGMP which may open a cyclic nucleotide-suppressible cation channel leading to influx of calcium, ultimately leading to release of neurotransmitter. Indeed, denatonium and strychnine induce transient reduction in cAMP and cGMP in taste tissue, whereas this decrease is inhibited by GNAT3 antibody. Gustducin heterotrimer transduces response to bitter and sweet compounds via regulation of phosphodiesterase for alpha subunit, as well as via activation of phospholipase C for beta and gamma subunits, with ultimate increase inositol trisphosphate and increase of intracellular Calcium. GNAT3 can functionally couple to taste receptors to transmit intracellular signal: receptor heterodimer TAS1R2/TAS1R3 senses sweetness and TAS1R1/TAS1R3 transduces umami taste, whereas the T2R family GPCRs act as bitter sensors. Functions also as lumenal sugar sensors in the gut to control the expression of the Na+-glucose transporter SGLT1 in response to dietaty sugar, as well as the secretion of Glucagon-like peptide-1, GLP-1 and glucose-dependent insulinotropic polypeptide, GIP. Thus, may modulate the gut capacity to absorb sugars, with implications in malabsorption syndromes and diet-related disorders including diabetes and obesity.
Target Subcellular Location
Cytoplasm. Note=Dual distribution pattern; plasmalemmal pattern with apical region localization and cytosolic pattern with localization throughout the cytoplasm.
Target Protein Families
G-alpha family, G(i/o/t/z) subfamily
Target Tissue Specificity
Expressed in taste buds (sensory organs of clustered epithelial cells) of the circumvallate and foliate papillae of the tongue at protein level. Expressed in enteroendocrine L cells of the gut. Detected also in spermatozoa.
Target Synonyms
GDCA; Ggust; Gnat 3; GNAT3; GNAT3_HUMAN; Gtn; Guanine nucleotide binding protein alpha transducing 3; Guanine nucleotide binding protein G(t) subunit alpha 3; Guanine nucleotide-binding protein G(t) subunit alpha-3; Gustducin alpha 3; Gustducin alpha 3 chain; Gustducin alpha-3 chain
Target Background
Sweet, bitter, and umami tastes are transmitted from taste receptors by a specific guanine nucleotide binding protein. The protein encoded by this gene is the alpha subunit of this heterotrimeric G protein, which is found not only in the oral epithelium but also in gut tissues. Variations in this gene have been linked to metabolic syndrome.
Notification