Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF149 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 221-400 of human RNF149 (NP_775918.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RNF149 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 221-400 of human RNF149 (NP_775918.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10074A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF149 |
| Target Synonyms | DNAPTP2; RNF149 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 221-400 of human RNF149 (NP_775918.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGSDDSSPPSASPAESEPQCDPSFKGDAGENTALLEAGRSDSRHGGPIS | Uniprot ID | Q8NC42 |
Uniprot Id
Q8NC42
Target Species
Human
Target Name
RNF149
Target Full Name
E3 ubiquitin-protein ligase RNF149
Target Function
E3 ubiquitin-protein ligase. Ubiquitinates BRAF, inducing its proteasomal degradation.
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Synonyms
RNF149; DNAPTP2; E3 ubiquitin-protein ligase RNF149; DNA polymerase-transactivated protein 2; RING finger protein 149; RING-type E3 ubiquitin transferase RNF149
Target Background
Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within cellular response to xenobiotic stimulus; negative regulation of MAPK cascade; and regulation of protein stability. Located in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
