-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRB10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GRB10 (NP_005302.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRB10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GRB10 (NP_005302.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10380A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRB10 |
| Target Synonyms | RSS; IRBP; MEG1; GRB-IR; Grb-10; GRB10 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GRB10 (NP_005302.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQ | Uniprot ID | Q13322 |
Uniprot Id
Q13322
Target Species
Human
Target Name
GRB10
Target Full Name
Growth factor receptor-bound protein 10
Target Function
Adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. Binds to, and suppress signals from, activated receptors tyrosine kinases, including the insulin (INSR) and insulin-like growth factor (IGF1R) receptors. The inhibitory effect can be achieved by 2 mechanisms: interference with the signaling pathway and increased receptor degradation. Delays and reduces AKT1 phosphorylation in response to insulin stimulation. Blocks association between INSR and IRS1 and IRS2 and prevents insulin-stimulated IRS1 and IRS2 tyrosine phosphorylation. Recruits NEDD4 to IGF1R, leading to IGF1R ubiquitination, increased internalization and degradation by both the proteasomal and lysosomal pathways. May play a role in mediating insulin-stimulated ubiquitination of INSR, leading to proteasomal degradation. Negatively regulates Wnt signaling by interacting with LRP6 intracellular portion and interfering with the binding of AXIN1 to LRP6. Positive regulator of the KDR/VEGFR-2 signaling pathway. May inhibit NEDD4-mediated degradation of KDR/VEGFR-2.
Target Subcellular Location
Cytoplasm.
Target Protein Families
GRB7/10/14 family
Target Tissue Specificity
Widely expressed in fetal and adult tissues, including fetal and postnatal liver, lung, kidney, skeletal muscle, heart, spleen, skin and brain.
Target Synonyms
grb 10; GRB IR; grb-10; GRB10 adapter protein; GRB10 adaptor protein; GRB10; GRB10_HUMAN; GRBIR; Growth factor receptor bound protein 10; Growth factor receptor-bound protein 10; Insulin receptor binding protein; Insulin receptor binding protein GRB IR; Insulin receptor-binding protein Grb-IR; IRBP; KIAA0207; Maternally expressed gene 1; MEG1; RSS
Target Background
The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification