Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human KLF8 (NP_009181.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KLF8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human KLF8 (NP_009181.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10450A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF8 |
| Target Synonyms | BKLF3; ZNF741; KLF8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human KLF8 (NP_009181.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAG | Uniprot ID | O95600 |
Uniprot Id
O95600
Target Species
Human
Target Name
KLF8
Target Full Name
Krueppel-like factor 8
Target Function
Transcriptional repressor and activator. Binds to CACCC-boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G(1) phase as a downstream target of focal adhesion kinase (FAK).
Target Subcellular Location
Nucleus.
Target Protein Families
Sp1 C2H2-type zinc-finger protein family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Basic krueppel-like factor 3; BKLF3; DXS741; KLF8; KLF8_HUMAN; Krueppel-like factor 8; Kruppel like factor 8; MGC138314; Zinc finger protein 741; ZNF741
Target Background
This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in the regulation of epithelial to mesenchymal transition, a process which occurs normally during development but also during metastasis. A pseudogene has been identified on chromosome 16. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
