-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMGB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB2 (NP_002120.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HMGB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB2 (NP_002120.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10458A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMGB2 |
| Target Synonyms | HMG2; HMGB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, PC-12, RAW264.7, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB2 (NP_002120.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDED | Uniprot ID | P26583 |
Uniprot Id
P26583
Target Species
Human
Target Name
HMGB2
Target Full Name
High mobility group protein B2
Target Function
Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription, chromatin remodeling and V(D)J recombination and probably other processes. Binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity. Involved in V(D)J recombination by acting as a cofactor of the RAG complex: acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Proposed to be involved in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor which cooperates with subsequent discriminative sensing by specific pattern recognition receptors. In the extracellular compartment acts as a chemokine. Promotes proliferation and migration of endothelial cells implicating AGER/RAGE. Has antimicrobial activity in gastrointestinal epithelial tissues. Involved in inflammatory response to antigenic stimulus coupled with proinflammatory activity. Involved in modulation of neurogenesis probably by regulation of neural stem proliferation. Involved in articular cartilage surface maintenance implicating LEF1 and the Wnt/beta-catenin pathway.
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm. Secreted.
Target Protein Families
HMGB family
Target Tissue Specificity
Expressed in gastric and intestinal tissues (at protein level).
Target Synonyms
C80539; High mobility group (nonhistone chromosomal) protein 2; High mobility group box 2; High mobility group protein 2; High mobility group protein B2; HMG 2; HMG B2; HMG-2; HMG2; HMGB2; HMGB2_HUMAN
Target Background
This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
Notification