-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GluR4/GluA4/GRIA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 254-433 of human GluR4/GluA4/GluR4/GluA4/GRIA4 (NP_001070712.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GluR4/GluA4/GRIA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 254-433 of human GluR4/GluA4/GluR4/GluA4/GRIA4 (NP_001070712.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10735A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GluR4/GluA4/GRIA4 |
| Target Synonyms | GLUR4; GLURD; GluA4; GLUR4C; NEDSGA; GluA4-ATD; GluR4/GluA4/GRIA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, B cells, Mouse brain, Mouse liver, Mouse spinal cord, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 254-433 of human GluR4/GluA4/GluR4/GluA4/GRIA4 (NP_001070712.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMPLMKNPILRN | Uniprot ID | P48058 |
Uniprot Id
P48058
Target Species
Human
Target Name
GRIA4
Target Full Name
Glutamate receptor 4
Target Function
Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell projection, dendrite.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRIA4 subfamily
Target Synonyms
AMPA 4; AMPA selective glutamate receptor 4; AMPA-selective glutamate receptor 4; AMPA4; GluA 4; GluA4; GluR 4; GluR D; GluR-4; GluR-D; GluR4; GLUR4C; GLURD; Glutamate receptor 4; Glutamate receptor ionotrophic AMPA 4; Glutamate receptor ionotropic; GRIA 4; Gria4; GRIA4_HUMAN; Ionotropic Glutamate receptor 4
Target Background
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing of this gene results in transcript variants encoding different isoforms, which may vary in their signal transduction properties. Some haplotypes of this gene show a positive association with schizophrenia.
Notification