-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEIS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-390 of human MEIS1 (NP_002389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MEIS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-390 of human MEIS1 (NP_002389.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10785A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEIS1 |
| Target Synonyms | MEIS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, Mouse lung, Mouse pancreas | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-390 of human MEIS1 (NP_002389.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM | Uniprot ID | O00470 |
Uniprot Id
O00470
Target Species
Human
Target Name
MEIS1
Target Full Name
Homeobox protein Meis1
Target Function
Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.
Target Involvement
Restless legs syndrome 7 (RLS7)
Target Subcellular Location
Nucleus.
Target Protein Families
TALE/MEIS homeobox family
Target Tissue Specificity
Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high leve
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Homeo box protein Meis1; Homeobox protein Meis1; Leukemogenic homolog protein; MEIS 1; Meis homeo box 1; Meis homeobox 1; Meis1; Meis1 mouse homolog; Meis1 myeloid ecotropic viral integration site 1 homolog; Meis1 myeloid ecotropic viral integration site 1 homolog mouse; MEIS1 protein; MEIS1_HUMAN; MGC43380; Myeloid ecotropic viral integration site 1 homolog ; WUGSC:H NH0444B04.1
Target Background
Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins.
Notification