-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLAU was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-180 of human PLAU (NP_002649.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLAU was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-180 of human PLAU (NP_002649.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10811A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLAU |
| Target Synonyms | ATF; QPD; UPA; URK; u-PA; BDPLT5; PLAU | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, HT-1080, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-180 of human PLAU (NP_002649.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII | Uniprot ID | P00749 |
Uniprot Id
P00749
Target Species
Human
Target Name
PLAU
Target Full Name
Urokinase-type plasminogen activator
Target Function
Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Target Involvement
Quebec platelet disorder (QPD)
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase S1 family
Target Tissue Specificity
Expressed in the prostate gland and prostate cancers.
Target Research Area
Cardiovascular
Target Synonyms
ATF; ATF uPA; BDPLT5; Plasminogen activator; Plasminogen activator urinary; Plasminogen activator urokinase; PLAU; QPD; u PA; U plasminogen activator; u-PA; U-plasminogen activator; uPA; URK; UROK_HUMAN; Urokinase plasminogen activator; Urokinase type plasminogen activator; Urokinase type plasminogen activator precursor; Urokinase-type plasminogen activator chain B
Target Background
This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Notification