-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP5D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human ATP5D (NP_001678.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ATP5D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human ATP5D (NP_001678.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10860A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP5D |
| Target Synonyms | ATP5D; MC5DN5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, A-549, HepG2, MCF7, Mouse liver, Raji, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human ATP5D (NP_001678.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE | Uniprot ID | P30049 |
Uniprot Id
P30049
Target Species
Human
Target Name
ATP5F1D
Target Full Name
ATP synthase subunit delta, mitochondrial
Target Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Target Subcellular Location
Mitochondrion. Mitochondrion inner membrane.
Target Protein Families
ATPase epsilon chain family
Target Research Area
Metabolism, Tags & Cell Markers
Target Synonyms
ATP synthase subunit delta; mitochondrial ; ATP synthase subunit delta; mitochondrial; ATP synthase; H+ transporting; mitochondrial F1 complex; delta subunit; ATP5D; ATPD_HUMAN; F ATPase delta subunit ; F-ATPase delta subunit; Mitochondrial ATP synthase complex delta subunit precusor ; Mitochondrial ATP synthase delta subunit
Target Background
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified.
Notification