-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HGF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 106-160 of human HGF (NP_000592.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HGF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 106-160 of human HGF (NP_000592.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10992A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HGF |
| Target Synonyms | SF; HGFB; HPTA; F-TCF; DFNB39; HGF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 106-160 of human HGF (NP_000592.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEH | Uniprot ID | P14210 |
Uniprot Id
P14210
Target Species
Human
Target Name
HGF
Target Full Name
Hepatocyte growth factor
Target Function
Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
Target Involvement
Deafness, autosomal recessive, 39 (DFNB39)
Target Protein Families
Peptidase S1 family, Plasminogen subfamily
Target Synonyms
DFNB39; F TCF; Fibroblast derived tumor cytotoxic factor; Hepatocyte growth factor (hepapoietin A; scatter factor); Hepatocyte growth factor; Hepatocyte growth factor beta chain; Hepatocyte growth factor precursor; Hepatopoietin A; Hepatopoietin-A; Hgf; HGF_HUMAN; HGFB; HPTA; Lung fibroblast derived mitogen; OTTHUMP00000161349; OTTHUMP00000206710; OTTHUMP00000206711; OTTHUMP00000206712; OTTHUMP00000206713; OTTHUMP00000206730; Scatter factor; SF
Target Background
This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss.
Notification