-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-162 of human IL21 (NP_068575.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IL21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-162 of human IL21 (NP_068575.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11046A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL21 |
| Target Synonyms | Za11; IL-21; CVID11; IL21 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus, Raji, Rat spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-162 of human IL21 (NP_068575.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS | Uniprot ID | Q9HBE4 |
Uniprot Id
Q9HBE4
Target Species
Human
Target Name
IL21
Target Full Name
Interleukin-21
Target Function
Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells. Implicated in the generation and maintenance of T follicular helper (Tfh) cells and the formation of germinal-centers. Together with IL6, control the early generation of Tfh cells and are critical for an effective antibody response to acute viral infection. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
Target Involvement
Immunodeficiency, common variable, 11 (CVID11)
Target Subcellular Location
Secreted.
Target Protein Families
IL-15/IL-21 family
Target Tissue Specificity
Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.
Target Research Area
Immunology
Target Synonyms
CVID11; IL 21; IL-21; Il21; IL21_HUMAN; Interleukin 21; Interleukin-21; interleukin-21 isoform; Interleukin21; OTTHUMP00000164088; Za11
Target Background
This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification