Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTFP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human MTFP1 (NP_057582.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MTFP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human MTFP1 (NP_057582.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11052A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTFP1 |
| Target Synonyms | MTP18; HSPC242; MTFP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human MTFP1 (NP_057582.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS | Uniprot ID | Q9UDX5 |
Uniprot Id
Q9UDX5
Target Species
Human
Target Name
MTFP1
Target Full Name
Mitochondrial fission process protein 1
Target Function
Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
MTFP1 family
Target Research Area
Tags & Cell Markers
Target Synonyms
HSPC 242; HSPC242; Mitochondrial 18 kDa protein; Mitochondrial fission process protein 1; Mitochondrial fission protein MTP18; Mitochondrial protein 18 kDa; MTFP1; MTFP1_HUMAN; MTP 18; MTP18
Target Background
MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
