Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACAA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 210-310 human ACAA1(NP_001598.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACAA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 210-310 human ACAA1(NP_001598.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08364A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACAA1 |
| Target Synonyms | ACAA; THIO; PTHIO; Lnc-Myd88; ACAA1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 210-310 human ACAA1(NP_001598.1). | Immunogen Sequence | AARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVV |
|---|---|---|---|
| Uniprot ID | P09110 |
Uniprot Id
P09110
Target Species
Human
Target Name
ACAA1
Target Full Name
3-ketoacyl-CoA thiolase, peroxisomal
Target Function
Responsible for the thiolytic cleavage of straight chain 3-oxoacyl-CoAs. Catalyzes the cleavage of short, medium and long straight chain 3-oxoacyl-CoAs, medium chain 3-oxoacyl-CoAs being the best substrates.
Target Subcellular Location
Peroxisome.
Target Protein Families
Thiolase family
Target Research Area
Metabolism
Target Synonyms
3 ketoacyl CoA thiolase peroxisomal; 3-ketoacyl-CoA thiolase; ACAA; ACAA1; Acetyl CoA acyltransferase 1; Acetyl Coenzyme A acyltransferase 1; Acetyl-CoA acyltransferase; Acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3 oxoacyl Coenzyme A; Beta ketothiolase; Beta-ketothiolase; Peroxisomal 3 oxoacyl CoA thiolase; Peroxisomal 3 oxoacyl Coenzyme A thiolase; Peroxisomal 3-oxoacyl-CoA thiolase; peroxisomal; PTHIO; THIK_HUMAN; THIO
Target Background
This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
