Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BES1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of arabidopsis thaliana BES1 (NP_973865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BES1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of arabidopsis thaliana BES1 (NP_973865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07189A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BES1 |
| Target Synonyms | 107 PROTEIN; BRASSINAZOLE-RESISTANT 2; BRI1-EMS-SUPPRESSOR 1; BZR2; F18O14.7; F18O14_7; BES1 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Before inflorescence, Rosette leaf, Seedling | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of arabidopsis thaliana BES1 (NP_973865.1). | Immunogen Sequence | SSSRATPYSSHNQSPLSSTFDSPILSYQVSPSSSSFPSPSRVGDPHNISTIFPFLRNGGIPSSLPPLRISNSAPVTPPVSSPTSRNPKPLPTWESFTKQSM |
|---|---|---|---|
| Uniprot ID | Q9LN63 |
Uniprot Id
Q9LN63
Target Synonyms
107 PROTEIN; BRASSINAZOLE-RESISTANT 2; BRI1-EMS-SUPPRESSOR 1; BZR2; F18O14.7; F18O14_7; BES1
Target Background
Encodes brassinosteroid (BR) signalling protein that accumulates in the nucleus as dephosphorylated form in response to BRs. Is phosphorylated by the BIN2 GSK3 kinase. It synergistically interacts with BIM1 to bind to E box sequences (CANNTG). The protein contains a nuclear localization signal (NLS), followed by a highly conserved amino-terminal domain (N) shared by all family members, a BIN2 phosphorylation domain (P), a PEST motif, involved in protein degradation in the absence of BR, and a carboxyl-terminal domain. BES1 can interact with the ELF6 and REF6 Jumonji N/C-domain containing proteins and may direct them to modify histone methylation upstream of some brassinosteroid responsive-genes. Works with BRAVO to regulate QC division in the root.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
