Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BSU1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 694-793 of arabidopsis thaliana BSU1 (NP_171844.6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BSU1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 694-793 of arabidopsis thaliana BSU1 (NP_171844.6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00391A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BSU1 |
| Target Synonyms | BRI1 SUPPRESSOR 1; F21B7.7; BSU1 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Before inflorescence, Inflorescences, Seedling | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 694-793 of arabidopsis thaliana BSU1 (NP_171844.6). | Immunogen Sequence | FLERNGLEMILRAHECVIDGFERFADGRLITVFSATNYCGTAQNAGAILVIGRDMVIYPKLIHPHPPPISSSEEDYTDKAWMQELNIEMPPTPARGESSE |
|---|---|---|---|
| Uniprot ID | Q9LR78 |
Uniprot Id
Q9LR78
Target Synonyms
BRI1 SUPPRESSOR 1; F21B7.7; BSU1
Target Background
encodes a serine#Aeithreonine protein phosphatase with an N-terminal Kelch-repeat domain, which is nuclear localized and expressed preferentially in elongating cells. Genetic evidence suggest that this gene plays a redundant role (along with other members of the same gene family) in modulating growth in response to brassinosteroid.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
