Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COR28 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-170 of arabidopsis thaliana COR28 (NP_567946.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COR28 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-170 of arabidopsis thaliana COR28 (NP_567946.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06827A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COR28 |
| Target Synonyms | F17I5.170; F17I5_170; COR28 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Before inflorescence, Inflorescences, Rosette leaf, Seedling | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-170 of arabidopsis thaliana COR28 (NP_567946.1). | Immunogen Sequence | SKLDECTAWTNEKHNSYLDYLESSFVRQLYSLLGGGTQRLSRTRDVQSNSHKSADQFTVLQNGCWQKVNFGKKQSCLETSSEFRFHRNSLRNKPENSNGNYTMGTTVQGDVLCHDETKHSE |
|---|---|---|---|
| Uniprot ID | Q8L983 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
