-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Aconitase 1 (ACO1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human Aconitase 1 (ACO1) (NP_002188.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Aconitase 1 (ACO1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human Aconitase 1 (ACO1) (NP_002188.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10968A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Aconitase 1 (ACO1) |
| Target Synonyms | IRP1; ACONS; HEL60; IREB1; IREBP; IREBP1; Aconitase 1 (ACO1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat heart, HCT116, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human Aconitase 1 (ACO1) (NP_002188.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRII | Uniprot ID | P21399 |
Uniprot Id
P21399
Target Species
Human
Target Name
ACO1
Target Full Name
Cytoplasmic aconitate hydratase
Target Function
Bifunctional iron sensor that switches between 2 activities depending on iron availability. Iron deprivation, promotes its mRNA binding activity through which it regulates the expression of genes involved in iron uptake, sequestration and utilization. Binds to iron-responsive elements (IRES) in the untranslated region of target mRNAs preventing for instance the translation of ferritin and aminolevulinic acid synthase and stabilizing the transferrin receptor mRNA.; Conversely, when cellular iron levels are high, binds a 4Fe-4S cluster which precludes RNA binding activity and promotes the aconitase activity, the isomerization of citrate to isocitrate via cis-aconitate.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Aconitase/IPM isomerase family
Target Synonyms
ACO 1; ACO1; ACOC_HUMAN; Aconitase 1 soluble; Aconitase; Aconitase1; Aconitate hydratase; ACONS; Citrate hydro lyase; Citrate hydro-lyase; Cytoplasmic aconitate hydratase; Ferritin repressor protein; IRE BP 1; IRE-BP 1; IREB 1; IREB1; IREBP; IREBP1; Iron regulatory protein 1; Iron responsive element binding protein 1; Iron-responsive element-binding protein 1; IRP 1; IRP1; OTTHUMP00000045233
Target Background
The protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variants
Notification