-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACOX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ACOX2 (NP_003491.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ACOX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ACOX2 (NP_003491.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11139A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACOX2 |
| Target Synonyms | BCOX; BRCOX; CBAS6; THCCox; BRCACOX; ACOX2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, 293T-ACOX2-N | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ACOX2 (NP_003491.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQNERYKAAMRRAFHIRLIARRLGWLEDGRELGYAYRALSGDVALNIHRVFVRALRSLGSEEQIAKWDPLCKNIQIIAT | Uniprot ID | Q99424 |
Uniprot Id
Q99424
Target Species
Human
Target Name
ACOX2
Target Full Name
Peroxisomal acyl-coenzyme A oxidase 2
Target Function
Oxidizes the CoA esters of the bile acid intermediates di- and tri-hydroxycholestanoic acids. Capable of oxidizing short as well as long chain 2-methyl branched fatty acids.
Target Involvement
Congenital bile acid synthesis defect 6 (CBAS6)
Target Subcellular Location
Peroxisome.
Target Protein Families
Acyl-CoA oxidase family
Target Tissue Specificity
Present in all tissues tested: heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Most abundant in heart, liver and kidney.
Target Synonyms
12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase; 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase; 3 alpha 7 alpha 12 alpha trihydroxy 5 beta cholestanoyl CoA oxidase; 3 alpha 7 alpha12 alpha trihydroxy 5 beta cholestanoyl CoA 24 hydroxylase; 3-alpha; 7-alpha; ACOX 2; ACOX2; ACOX2_HUMAN; Acyl CoA oxidase 2; Acyl Coenzyme A oxidase 2; Acyl Coenzyme A oxidase 2 branched chain; Acyl coenzyme A oxidase 2 peroxisomal; BCOX; BRCACOX; BRCOX; Peroxisomal acyl-coenzyme A oxidase 2; Peroxisomal branched chain acyl CoA oxidase; THCA CoA oxidase; THCA-CoA oxidase; THCCox; Trihydroxycoprostanoyl CoA oxidase; Trihydroxycoprostanoyl-CoA oxidase
Target Background
The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe cognitive disability, and death in children.
Notification