Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACTC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTC1 (NP_005150.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ACTC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTC1 (NP_005150.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02989A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACTC1 |
| Target Synonyms | ACTC; ASD5; CMD1R; CMH11; LVNC4; ACTC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, C2C12, H9C2, Mouse lung, Rat lung, RD | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTC1 (NP_005150.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAP | Uniprot ID | P68032 |
Uniprot Id
P68032
Target Species
Human
Target Name
ACTC1
Target Full Name
Actin, alpha cardiac muscle 1
Target Function
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Target Involvement
Cardiomyopathy, dilated 1R (CMD1R); Cardiomyopathy, familial hypertrophic 11 (CMH11); Atrial septal defect 5 (ASD5)
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Actin family
Target Research Area
Cardiovascular
Target Synonyms
ACTC; ACTC_HUMAN; ACTC1; Actin alpha cardiac muscle 1; Actin; alpha cardiac muscle 1; Alpha-cardiac actin; ASD5; CMD1R; CMH11; LVNC4
Target Background
Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
