-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACTL7B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human ACTL7B (NP_006677.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACTL7B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human ACTL7B (NP_006677.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03466A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACTL7B |
| Target Synonyms | Tact1; ACTL7B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, Mouse brain, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human ACTL7B (NP_006677.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERKTSV | Uniprot ID | Q9Y614 |
Uniprot Id
Q9Y614
Target Species
Human
Target Name
ACTL7B
Target Full Name
Actin-like protein 7B
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Actin family
Target Tissue Specificity
Detected only in the testis and, to a lesser extent, in the prostate.
Target Synonyms
ACL7B_HUMAN; Actin like 7 beta; Actin like 7B; Actin like protein 7B; Actin-like protein 7B; Actin-like-7-beta; ACTL7B; MGC151192; MGC151194; OTTHUMP00000021867; OTTMUSP00000007742; RP11-3J11.2; RP23-48F4.1; t actin 1; Tact1
Target Background
The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.
Notification