-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADRA2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human ADRA2C (NP_000674.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADRA2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human ADRA2C (NP_000674.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06874A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADRA2C |
| Target Synonyms | ADRA2L2; ADRARL2; ADRA2RL2; ALPHA2CAR; ADRA2C | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human ADRA2C (NP_000674.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKRF | Uniprot ID | P18825 |
Uniprot Id
P18825
Target Species
Human
Target Name
ADRA2C
Target Full Name
Alpha-2C adrenergic receptor
Target Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2C sub-subfamily
Target Synonyms
ADRA2C; ADRA2L2; ADRA2RL2; Alpha-2C adrenergic receptor; Alpha-2 adrenergic receptor subtype C4; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2CAR
Target Background
Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. They include 3 highly homologous subtypes: alpha2A, alpha2B, and alpha2C. These receptors have a critical role in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. The mouse studies revealed that both the alpha2A and alpha2C subtypes were required for normal presynaptic control of transmitter release from sympathetic nerves in the heart and from central noradrenergic neurons. The alpha2A subtype inhibited transmitter release at high stimulation frequencies, whereas the alpha2C subtype modulated neurotransmission at lower levels of nerve activity. This gene encodes the alpha2C subtype, which contains no introns in either its coding or untranslated sequences.
Notification