Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDH3A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human ALDH3A2 (NP_001026976.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ALDH3A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human ALDH3A2 (NP_001026976.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06671A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDH3A2 |
| Target Synonyms | SLS; FALDH; ALDH10; ALDH3A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse testis, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human ALDH3A2 (NP_001026976.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKIAFGGETDEATRYIAPTVLTD | Uniprot ID | P51648 |
Uniprot Id
P51648
Target Species
Human
Target Name
ALDH3A2
Target Full Name
Aldehyde dehydrogenase family 3 member A2
Target Function
Catalyzes the oxidation of medium and long chain aliphatic aldehydes to fatty acids. Active on a variety of saturated and unsaturated aliphatic aldehydes between 6 and 24 carbons in length. Responsible for conversion of the sphingosine 1-phosphate (S1P) degradation product hexadecenal to hexadecenoic acid.
Target Involvement
Sjoegren-Larsson syndrome (SLS)
Target Subcellular Location
Microsome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side.
Target Protein Families
Aldehyde dehydrogenase family
Target Tissue Specificity
Detected in liver (at protein level).
Target Synonyms
ALDH3A2; ALDH10; FALDH; Aldehyde dehydrogenase family 3 member A2; Aldehyde dehydrogenase 10; Fatty aldehyde dehydrogenase; Microsomal aldehyde dehydrogenase
Target Background
Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
