-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALOX15B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ALOX15B (NP_001132.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ALOX15B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ALOX15B (NP_001132.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11071A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALOX15B |
| Target Synonyms | 15-LOX-2; ALOX15B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-431, MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ALOX15B (NP_001132.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGL | Uniprot ID | O15296 |
Uniprot Id
O15296
Target Species
Human
Target Name
ALOX15B
Target Full Name
Polyunsaturated fatty acid lipoxygenase ALOX15B
Target Function
Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids (PUFAs) generating a spectrum of bioactive lipid mediators (Probable). It inserts peroxyl groups at C15 of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) producing (15S)-hydroperoxyeicosatetraenoate/(15S)-HPETE (Probable). Also peroxidizes linoleate ((9Z,12Z)-octadecadienoate) to 13-hydroperoxyoctadecadienoate/13-HPODE (Probable). Oxygenates arachidonyl derivatives such as 2-arachidonoylglycerol (2-AG) leading to the production and extracellular release of 15-hydroxyeicosatetraenoyl glycerol (15-HETE-G) that acts as a peroxisome proliferator-activated receptor alpha agonist. Has the ability to efficiently class-switch ALOX5 pro-inflammatory mediators into anti-inflammatory intermediates. Participates in the sequential oxidations of DHA ((4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate) to generate specialized pro-resolving mediators (SPMs) resolvin D5 ((7S,17S)-diHPDHA), which can actively downregulate the immune response and have anti-aggregation properties with platelets. In addition to free PUFAs hydrolyzed from phospholipids, it directly oxidizes PUFAs esterified to membrane-bound phospholipids. Has no detectable 8S-lipoxygenase activity on arachidonate but reacts with (8S)-HPETE to produce (8S,15S)-diHPETE (Probable). May regulate progression through the cell cycle and cell proliferation. May also regulate cytokine secretion by macrophages and therefore play a role in the immune response. May also regulate macrophage differentiation into proatherogenic foam cells.; Does not convert arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid/(15S)-HPETE.
Target Subcellular Location
[Isoform A]: Nucleus.; Cytoplasm, cytosol. Cell membrane. Cytoplasm, cytoskeleton. Membrane; Peripheral membrane protein. Cell junction, adherens junction. Cell junction, focal adhesion.
Target Protein Families
Lipoxygenase family
Target Tissue Specificity
Expressed in hair, prostate, lung, ovary, lymph node, spinal cord and cornea.
Target Synonyms
15 Lipoxygenase 2; 15 LO 2; 15 LOX 2; 15-lipoxygenase 2; 15-LOX-2; 15-LOX-B; Alox15b; Arachidonate 15 lipoxygenase second type; Arachidonate 15 lipoxygenase type II; Arachidonate 15-lipoxygenase B; Arachidonate 15-lipoxygenase type II; LX15B_HUMAN
Target Background
This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification