Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AMY1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-200 of human AMY1A (NP_004029.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AMY1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-200 of human AMY1A (NP_004029.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02819A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AMY1A |
| Target Synonyms | AMY1; AMY1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse liver, Mouse pancreas, Rat liver, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 16-200 of human AMY1A (NP_004029.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNH | Uniprot ID | P04745 |
Uniprot Id
P04745
Target Species
Human
Target Name
AMY1A
Target Synonyms
amylase; salivary; B; 1 4 alpha D glucan glucanohydrolase; 1; 1,4 alpha D glucan glucanohydrolase 2B; 1,4-alpha-D-glucan glucanohydrolase 1; 4-alpha-D-glucan glucanohydrolase 1; Alpha amylase; Alpha-amylase 1; AMY1; AMY1_HUMAN; AMY1C; AMY2; AMY2B; AMY3; amylase; alpha 1A (salivary); Amylase; alpha 1B (salivary); amylase; alpha 1C (salivary); amylase; salivary; alpha-1A; amylase; salivary; alpha-1B; amylase; salivary; alpha-1C; amylase; salivary; C; glycogenase; HXA; PA; Salivary alpha-amylase; salivary amylase alpha 1A; salivary amylase alpha 1B; salivary amylase alpha 1C
Target Background
Amylases are secreted proteins that hydrolyze 1, 4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
