Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANKH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-320 of human ANKH (NP_473368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANKH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-320 of human ANKH (NP_473368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08899A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANKH |
| Target Synonyms | ANK; CMDJ; HANK; MANK; CCAL2; CPPDD; SLC62A1; ANKH | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | OVCAR3, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-320 of human ANKH (NP_473368.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGYYKNIHDIIPDRSGPELGGDATIRKMLSFWWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVYPAFDKNNPSNKLVSTSNTVT | Uniprot ID | Q9HCJ1 |
Uniprot Id
Q9HCJ1
Target Species
Human
Target Name
ANKH
Target Full Name
Mineralization regulator ANKH
Target Function
Regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.
Target Involvement
Chondrocalcinosis 2 (CCAL2); Craniometaphyseal dysplasia, autosomal dominant (CMDD)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
ANKH family
Target Tissue Specificity
Found in osteoblasts from mandibular bone and from iliac bone; not detected in osteoclastic cells.
Target Synonyms
ANK; ANKH; ANKH_HUMAN; Ankylosis progressive homolog (mouse); Ankylosis progressive homolog; CCAL 2; CCAL2; CMDJ; CPPDD; Craniometaphyseal dysplasia Jackson type (dominant); FLJ27166; HANK; MANK; Progressive ankylosis protein homolog
Target Background
This gene encodes a multipass transmembrane protein that is expressed in joints and other tissues and controls pyrophosphate levels in cultured cells. Progressive ankylosis-mediated control of pyrophosphate levels has been suggested as a possible mechanism regulating tissue calcification and susceptibility to arthritis in higher animals. Mutations in this gene have been associated with autosomal dominant craniometaphyseal dysplasia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
