-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANKRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ANKRD1 (NP_055206.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANKRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ANKRD1 (NP_055206.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14754A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANKRD1 |
| Target Synonyms | ALRP; CARP; C-193; CVARP; MCARP; bA320F15.2; ANKRD1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, HUVEC | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ANKRD1 (NP_055206.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE | Uniprot ID | Q15327 |
Uniprot Id
Q15327
Target Species
Human
Target Name
ANKRD1
Target Full Name
Ankyrin repeat domain-containing protein 1
Target Function
May play an important role in endothelial cell activation. May act as a nuclear transcription factor that negatively regulates the expression of cardiac genes. Induction seems to be correlated with apoptotic cell death in hepatoma cells.
Target Involvement
Total anomalous pulmonary venous return (TAPVR)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Mainly expressed in activated vascular endothelial cells. To a lower extent, also expressed in hepatoma cells.
Target Synonyms
ALRP; ANKR1_HUMAN; ANKRD 1; ANKRD1; Ankyrin repeat domain 1 (cardiac muscle); Ankyrin repeat domain containing protein 1 ; Ankyrin repeat domain-containing protein 1; bA320F15.2 ; C 193; C193; Cardiac ankyrin repeat protein; CARP; CVARP; Cytokine inducible nuclear protein; Cytokine-inducible gene C-193 protein; Cytokine-inducible nuclear protein; HA1A2; Liver ankyrin repeat domain 1 ; MCARP; OTTHUMP00000020084
Target Background
The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system.
Notification