-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AP1B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human AP1B1 (NP_001118.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AP1B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human AP1B1 (NP_001118.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06691A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AP1B1 |
| Target Synonyms | ADTB1; BAM22; KIDAR; AP105A; CLAPB2; AP1B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, 293T, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human AP1B1 (NP_001118.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTV | Uniprot ID | Q10567 |
Uniprot Id
Q10567
Target Species
Human
Target Name
AP1B1
Target Full Name
AP-1 complex subunit beta-1
Target Function
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Target Subcellular Location
Golgi apparatus. Cytoplasmic vesicle, clathrin-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Note=Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
Target Protein Families
Adaptor complexes large subunit family
Target Tissue Specificity
Widely expressed.
Target Research Area
Signal Transduction
Target Synonyms
Adaptin; beta 2 (beta); Adaptor protein complex AP-1 subunit beta-1; Adaptor related protein complex 1; beta 1 subunit; Adaptor related protein complex 2; beta 1 subunit; Adaptor-related protein complex 1 subunit beta-1; ADTB1; ADTB2; AP 1 complex subunit beta 1; AP 2 complex subunit beta 1; AP-1 complex subunit beta-1; AP1 Beta; AP1B1; AP1B1_HUMAN; AP2 Beta; AP2B1; Beta-1-adaptin; Beta-adaptin 1; Beta1 adaptin; Beta2 adaptin; CLAPB1; CLAPB2; Clathrin assembly protein complex 1 beta large chain; Golgi adaptor HA1/AP1 adaptin beta subunit
Target Background
Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as one of the large subunits of this complex and is a member of the adaptin protein family. This gene is a candidate meningioma gene. Alternative splicing results in multiple transcript variants.
Notification