-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ARF1 (NP_001649.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ARF1 (NP_001649.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02395A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARF1 |
| Target Synonyms | PVNH8; ARF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, BT-474, Rat kidney, SH-SY5Y, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ARF1 (NP_001649.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK | Uniprot ID | P84077 |
Uniprot Id
P84077
Target Species
Human
Target Name
ARF1
Target Full Name
ADP-ribosylation factor 1
Target Function
GTP-binding protein involved in protein trafficking among different compartments. Modulates vesicle budding and uncoating within the Golgi complex. Deactivation induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, suggesting a crucial role in protein trafficking. In its GTP-bound form, its triggers the association with coat proteins with the Golgi membrane. The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles. The GTP-bound form interacts with PICK1 to limit PICK1-mediated inhibition of Arp2/3 complex activity; the function is linked to AMPA receptor (AMPAR) trafficking, regulation of synaptic plasicity of excitatory synapses and spine shrinkage during long-term depression (LTD).; (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
Target Subcellular Location
Golgi apparatus. Cytoplasm, perinuclear region. Cell junction, synapse, synaptosome. Cell junction, synapse, postsynaptic density. Membrane; Lipid-anchor. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor.
Target Protein Families
Small GTPase superfamily, Arf family
Target Research Area
Signal Transduction
Target Synonyms
ADP Ribosylation Factor 1; ADP-ribosylation factor 1; ARF 1; ARF1; ARF1_HUMAN
Target Background
ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Notification