Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARL4D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 92-201 of human ARL4D (NP_001652.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ARL4D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 92-201 of human ARL4D (NP_001652.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06556A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARL4D |
| Target Synonyms | ARF4L; ARL4D | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 92-201 of human ARL4D (NP_001652.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR | Uniprot ID | P49703 |
Uniprot Id
P49703
Target Species
Human
Target Name
ARL4D
Target Full Name
ADP-ribosylation factor-like protein 4D
Target Function
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
Target Subcellular Location
Nucleus, nucleolus. Cell membrane. Nucleus. Cytoplasm.
Target Protein Families
Small GTPase superfamily, Arf family
Target Research Area
Signal Transduction
Target Synonyms
ADP ribosylation factor 4 like; ADP ribosylation factor like 4D; ADP ribosylation factor like 6; ADP ribosylation factor like protein 4D; ADP ribosylation factor like protein 4L; ADP-ribosylation factor-like protein 4D; ADP-ribosylation factor-like protein 4L; AR L6; ARF 4L; ARF4L; ARL 4D; ARL 6; ARL4D; ARL4D_HUMAN; ARL6
Target Background
ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
