-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARMCX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human ARMCX3 (NP_057691.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARMCX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human ARMCX3 (NP_057691.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00941A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARMCX3 |
| Target Synonyms | ALEX3; GASP6; dJ545K15.2; ARMCX3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human ARMCX3 (NP_057691.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILE | Uniprot ID | Q9UH62 |
Uniprot Id
Q9UH62
Target Species
Human
Target Name
ARMCX3
Target Full Name
Armadillo repeat-containing X-linked protein 3
Target Function
Regulates mitochondrial aggregation and transport in axons in living neurons. May link mitochondria to the TRAK2-kinesin motor complex via its interaction with Miro and TRAK2. Mitochondrial distribution and dynamics is regulated through ARMCX3 protein degradation, which is promoted by PCK and negatively regulated by WNT1. Enhances the SOX10-mediated transactivation of the neuronal acetylcholine receptor subunit alpha-3 and beta-4 subunit gene promoters.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Cytoplasm. Nucleus.
Target Protein Families
Eutherian X-chromosome-specific Armcx family
Target Synonyms
ALEX3; GASP6; dJ545K15.2; ARMCX3
Target Background
This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene.
Notification