Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARSG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human ARSG (NP_001254656.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARSG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human ARSG (NP_001254656.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05788A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARSG |
| Target Synonyms | USH4; ARSG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 376-525 of human ARSG (NP_001254656.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGALQTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLPEVRKVLADVLQDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA | Uniprot ID | Q96EG1 |
Uniprot Id
Q96EG1
Target Species
Human
Target Name
ARSG
Target Full Name
Arylsulfatase G
Target Function
Displays arylsulfatase activity at acidic pH towards artificial substrates, such as p-nitrocatechol sulfate and also, but with a lower activity towards p-nitrophenyl sulfate and 4-methylumbelliferyl sulfate. Catalyzes the hydrolysis of the 3-sulfate groups of the N-sulfo-D-glucosamine 3-O-sulfate units of heparin.
Target Subcellular Location
Lysosome.
Target Protein Families
Sulfatase family
Target Tissue Specificity
Widely expressed, with very low expression in brain, lung, heart and skeletal muscle.
Target Research Area
Tags & Cell Markers
Target Synonyms
Arsg; ARSG_HUMAN; Arylsulfatase G; Arylsulfatase G precursor ; ASG; KIAA1001; PRO1777; UNQ839
Target Background
The protein encoded by this gene belongs to the sulfatase enzyme family. Sulfatases hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules. This protein displays arylsulfatase activity at acidic pH, as is typical of lysosomal sulfatases, and has been shown to localize in the lysosomes. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
