-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 41-140 of human Apg12 (O94817) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATG12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 41-140 of human Apg12 (O94817) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16536A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG12 |
| Target Synonyms | APG12; FBR93; APG12L; HAPG12; ATG12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse stomach, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 41-140 of human Apg12 (O94817). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG | Uniprot ID | O94817 |
Uniprot Id
O94817
Target Species
Human
Target Name
ATG12
Target Full Name
Ubiquitin-like protein ATG12
Target Function
Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes.; (Microbial infection) May act as a proviral factor. In association with ATG5, negatively regulates the innate antiviral immune response by impairing the type I IFN production pathway upon vesicular stomatitis virus (VSV) infection. Required for the translation of incoming hepatitis C virus (HCV) RNA and, thereby, for the initiation of HCV replication, but not required once infection is established.
Target Subcellular Location
Cytoplasm. Preautophagosomal structure membrane; Peripheral membrane protein. Note=TECPR1 recruits the ATG12-ATG5 conjugate to the autolysosomal membrane.
Target Protein Families
ATG12 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Apg12; APG12-like; APG12L; ATG12; ATG12 autophagy related 12 homolog (S. cerevisiae); ATG12 autophagy related 12 homolog; ATG12_HUMAN; Autophagy 12; Autophagy-related protein 12; FBR93; HAPG12; Ubiquitin-like protein ATG12
Target Background
Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).
Notification