Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATOH7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 47-152 of human ATOH7 (NP_660161.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ATOH7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 47-152 of human ATOH7 (NP_660161.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Immunofluorescence analysis of A-549 cells using ATOH7 Rabbit pAb.Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution.
| Cat.No | ADA-02600A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATOH7 |
| Target Synonyms | Math5; NCRNA; RNANC; PHPVAR; bHLHa13; ATOH7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 47-152 of human ATOH7 (NP_660161.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT | Uniprot ID | Q8N100 |
Uniprot Id
Q8N100
Target Species
Human
Target Name
ATOH7
Target Full Name
Transcription factor ATOH7
Target Function
Transcription factor that positively regulates the determination of retinal ganglion cell fate and formation of the optic nerve and retino-hypothalamic tract. Required for retinal circadian rhythm photoentrainment.
Target Involvement
Persistent hyperplastic primary vitreous, autosomal recessive (PHPVAR)
Target Subcellular Location
Nucleus.
Target Synonyms
ATOH7; ATOH7_HUMAN; Atonal homolog 7 (Drosophila); Atonal Homolog 7; bHLHa13; Class A basic helix-loop-helix protein 13; hATH5; Helix-loop-helix protein hATH-5; Math5; Protein atonal homolog 7
Target Background
This intronless gene encodes a member of the basic helix-loop-helix family of transcription factors, with similarity to Drosophila atonal gene that controls photoreceptor development. Studies in mice suggest that this gene plays a central role in retinal ganglion cell and optic nerve formation. Mutations in this gene are associated with nonsyndromic congenital retinal nonattachment.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
