-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAIAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-521 of human BAIAP2 (NP_059344.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BAIAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-521 of human BAIAP2 (NP_059344.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09710A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAIAP2 |
| Target Synonyms | BAP2; WAML; FLAF3; IRSP53; BAIAP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 362-521 of human BAIAP2 (NP_059344.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSSGSGTLVSTV | Uniprot ID | Q9UQB8 |
Uniprot Id
Q9UQB8
Target Species
Human
Target Name
BAIAP2
Target Full Name
BAR/IMD domain-containing adapter protein 2
Target Function
Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin cytoskeleton by WASF family members and the Arp2/3 complex. Plays a role in neurite growth. Acts syngeristically with ENAH to promote filipodia formation. Plays a role in the reorganization of the actin cytoskeleton in response to bacterial infection. Participates in actin bundling when associated with EPS8, promoting filopodial protrusions.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein. Cell projection, filopodium. Cell projection, ruffle. Cytoplasm, cytoskeleton. Note=Detected throughout the cytoplasm in the absence of specific binding partners. Detected in filopodia and close to membrane ruffles. Recruited to actin pedestals that are formed upon infection by bacteria at bacterial attachment sites.
Target Tissue Specificity
Isoform 1 and isoform 4 are expressed almost exclusively in brain. Isoform 4 is barely detectable in placenta, prostate and testis. A short isoform is ubiquitous, with the highest expression in liver, prostate, testis and placenta.
Target Synonyms
BAI-associated protein 2; BAI1 associated protein 2; BAI1-associated protein 2; BAIAP 2; Baiap2; BAIP2_HUMAN; BAP2; Brain-specific angiogenesis inhibitor 1-associated protein 2; Fas ligand-associated factor 3; FLAF3; Insulin receptor substrate p53; Insulin receptor substrate p53/p58; Insulin receptor substrate protein of 53 kDa; IRS-58; IRSp53; IRSp53/58; Protein BAP2
Target Background
The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification