-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bax was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (NP_620116.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Bax was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (NP_620116.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-17283A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAX |
| Target Synonyms | BCL2 Associated X; Bcl-2-Like Protein 4; Bcl2-L-4; BCL2L4; BAX | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-1080, Raji | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (NP_620116.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF | Uniprot ID | Q07812 |
Uniprot Id
Q07812
Target Species
Human
Target Name
BAX
Target Full Name
Apoptosis regulator BAX
Target Function
Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Target Subcellular Location
[Isoform Alpha]: Mitochondrion outer membrane; Single-pass membrane protein. Cytoplasm.; [Isoform Beta]: Cytoplasm.; [Isoform Gamma]: Cytoplasm.; [Isoform Delta]: Cytoplasm.
Target Protein Families
Bcl-2 family
Target Tissue Specificity
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lu
Target Research Area
Cancer
Target Synonyms
Bcl-2-like protein 4 (Bcl2-L-4)
Target Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
Notification