Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BBOX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human BBOX1 (NP_003977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BBOX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human BBOX1 (NP_003977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03664A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BBOX1 |
| Target Synonyms | BBH; BBOX; G-BBH; gamma-BBH; BBOX1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human BBOX1 (NP_003977.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT | Uniprot ID | O75936 |
Uniprot Id
O75936
Target Species
Human
Target Name
BBOX1
Target Full Name
Gamma-butyrobetaine dioxygenase
Target Function
Catalyzes the formation of L-carnitine from gamma-butyrobetaine.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Gamma-BBH/TMLD family
Target Tissue Specificity
Highly expressed in kidney; moderately expressed in liver; very low expression in brain.
Target Research Area
Metabolism
Target Synonyms
2-oxoglutarate dioxygenase; BBH; BBOX 1; BBOX; Bbox1; BODG_HUMAN; Butyrobetaine (gamma) 2 oxoglutarate dioxygenase (gamma butyrobetaine hydroxylase) 1; G BBH; Gamma BBH; Gamma butyrobetaine 2 oxoglutarate dioxygenase 1; Gamma butyrobetaine dioxygenase; Gamma butyrobetaine hydroxylase; Gamma-BBH; Gamma-butyrobetaine; Gamma-butyrobetaine dioxygenase; Gamma-butyrobetaine hydroxylase
Target Background
This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
