Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BFAR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human BFAR (NP_057645.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BFAR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human BFAR (NP_057645.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09074A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BFAR |
| Target Synonyms | BAR; RNF47; BFAR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, A-549, HepG2, Mouse brain, Mouse liver, SH-SY5Y, SKOV3, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human BFAR (NP_057645.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQM | Uniprot ID | Q9NZS9 |
Uniprot Id
Q9NZS9
Target Species
Human
Target Name
BFAR
Target Full Name
Bifunctional apoptosis regulator
Target Function
Apoptosis regulator. Has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Tissue Specificity
Expressed highly in brain, moderately in small intestine, weakly in testes and only faintly in liver and skeletal muscle. Not expressed in heart, kidney, lung and spleen.
Target Synonyms
BFAR; BAR; RNF47; Bifunctional apoptosis regulator; RING finger protein 47
Target Background
Enables caspase binding activity; protein-macromolecule adaptor activity; and ubiquitin protein ligase activity. Involved in negative regulation of IRE1-mediated unfolded protein response; proteasome-mediated ubiquitin-dependent protein catabolic process; and protein ubiquitination. Acts upstream of or within negative regulation of apoptotic process. Located in endoplasmic reticulum and membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
