-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BLOC1S6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human BLOC1S6 (NP_036520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BLOC1S6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human BLOC1S6 (NP_036520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03921A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BLOC1S6 |
| Target Synonyms | PA; HPS9; PLDN; BLOS6; PALLID; BLOC1S6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, HepG2, K-562, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human BLOC1S6 (NP_036520.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAK | Uniprot ID | Q9UL45 |
Uniprot Id
Q9UL45
Target Species
Human
Target Name
BLOC1S6
Target Full Name
Biogenesis of lysosome-related organelles complex 1 subunit 6
Target Function
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. May play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process.
Target Involvement
Hermansky-Pudlak syndrome 9 (HPS9)
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Target Protein Families
BLOC1S6 family
Target Tissue Specificity
Widely expressed.
Target Synonyms
Bloc1s6; iogenesis of lysosome-related organelles complex 1 subunit 6; PA; Pallid (mouse) homolog; PALLID; Pallid protein; Pallid protein homolog; Pallidin; Pallidin homolog (mouse); PLDN; PLDN_HUMAN; Syntaxin 13 binding protein; Syntaxin 13-interacting protein
Target Background
The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.
Notification