-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bmi1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Bmi1 (NP_005171.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against Bmi1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Bmi1 (NP_005171.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-12257A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BMI1 |
| Target Synonyms | PCGF4; RNF51; FLVI2/BMI1; flvi-2/bmi-1; Bmi1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, A-549, K-562, Mouse thymus, Rat testis, Rat thymus | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Bmi1 (NP_005171.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP | Uniprot ID | P35226 |
Uniprot Id
P35226
Target Species
Human
Target Name
BMI1
Target Full Name
Polycomb complex protein BMI-1
Target Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A. In the PRC1-like complex, regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Research Area
Transcription
Target Synonyms
B lymphoma Mo MLV insertion region (mouse); B lymphoma Mo MLV insertion region 1 homolog; Bmi 1; BMI1; BMI1 polycomb ring finger oncogene; BMI1_HUMAN; Flvi 2/bmi 1; FLVI2/BMI1; MGC12685; Murine leukemia viral (bmi 1) oncogene homolog; Oncogene BMI 1; PCGF 4; PCGF4; Polycomb complex protein BMI 1; Polycomb complex protein BMI-1; Polycomb group protein Bmi1; Polycomb group ring finger 4; Polycomb group RING finger protein 4; RING finger protein 51; RNF 51; RNF51
Target Background
This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.
Notification