-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BMP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BMP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12073A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BMP5 |
| Target Synonyms | BMP5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, H460, LO2, Mouse liver, Mouse lung, Mouse skeletal muscle, Mouse small intestine, NCI-H460, Rat liver, Rat lung, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH | Uniprot ID | P22003 |
Uniprot Id
P22003
Target Species
Human
Target Name
BMP5
Target Full Name
Bone morphogenetic protein 5
Target Function
Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including cartilage and bone formation or neurogenesis. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical pathway such as MAPK p38 signaling cascade to promote chondrogenic differentiation.
Target Subcellular Location
Secreted.
Target Protein Families
TGF-beta family
Target Tissue Specificity
Expressed in the lung and liver.
Target Synonyms
BMP 5; BMP-5; Bmp5; BMP5_HUMAN; Bone morphogenetic protein 5; MGC34244
Target Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone and cartilage development. Polymorphisms in this gene may be associated with osteoarthritis in human patients. This gene is differentially regulated in multiple human cancers. This gene encodes distinct protein isoforms that may be similarly proteolytically processed.
Notification