Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BNIP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-280 of human BNIP2 (NP_004321.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BNIP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-280 of human BNIP2 (NP_004321.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03111A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BNIP2 |
| Target Synonyms | NIP2; BNIP-2; BNIP2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, NCI-H460, SW480, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 125-280 of human BNIP2 (NP_004321.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGY | Uniprot ID | Q12982 |
Uniprot Id
Q12982
Target Species
Human
Target Name
BNIP2
Target Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
Target Function
Implicated in the suppression of cell death. Interacts with the BCL-2 and adenovirus E1B 19 kDa proteins.
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Note=Localizes to the nuclear envelope region and to other cytoplasmic structures.
Target Synonyms
BCL2/adenovirus E1B 19 kDa protein interacting protein 2; BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BCL2/adenovirus E1B 19kDa interacting protein 2; BNIP 2 ; Bnip2; BNIP2_HUMAN; NIP2
Target Background
This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
