Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BOC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human BOC (NP_150279.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BOC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human BOC (NP_150279.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02647A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BOC |
| Target Synonyms | Boi; CDON2; BOC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, Mouse brain, Mouse lung, Rat spinal cord, SKOV3, SW480, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human BOC (NP_150279.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLA | Uniprot ID | Q9BWV1 |
Uniprot Id
Q9BWV1
Target Species
Human
Target Name
BOC
Target Full Name
Brother of CDO
Target Function
Component of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells. Promotes differentiation of myogenic cells.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Note=Enriched at sites of cell-cell contact.
Target Tissue Specificity
Detected in skeletal muscle, heart, thymus, kidney and small intestine. Detected at lower levels in brain, placenta, lung and colon mucosa.
Target Synonyms
BOC; UNQ604/PRO1190Brother of CDO; Protein BOC
Target Background
The protein encoded by this gene is a member of the immunoglobulin/fibronectin type III repeat family. It is a component of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells, and promotes myogenic differentiation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
