Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BTG2/PC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human BTG2/PC3 (NP_006754.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BTG2/PC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human BTG2/PC3 (NP_006754.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08904A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BTG2/PC3 |
| Target Synonyms | PC3; APRO1; TIS21; BTG2/PC3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HepG2, HT-1080, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human BTG2/PC3 (NP_006754.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS | Uniprot ID | P78543 |
Uniprot Id
P78543
Target Species
Human
Target Name
BTG2
Target Full Name
Protein BTG2
Target Function
Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex. Activates mRNA deadenylation in a CNOT6 and CNOT7-dependent manner. In vitro can inhibit deadenylase activity of CNOT7 and CNOT8. Involved in cell cycle regulation. Could be involved in the growth arrest and differentiation of the neuronal precursors. Modulates transcription regulation mediated by ESR1. Involved in mitochondrial depolarization and neurite outgrowth.
Target Protein Families
BTG family
Target Synonyms
B cell translocation gene 2; BTG family member 2; Btg2; BTG2_HUMAN; Nerve growth factor inducible anti proliferative; NGF inducible anti proliferative protein PC3; NGF-inducible anti-proliferative protein PC3; PC3; Pheochromacytoma cell 3; Protein BTG2; TIS21
Target Background
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
