Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BYSL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BYSL (NP_004044.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BYSL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BYSL (NP_004044.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02117A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BYSL |
| Target Synonyms | Enp1; BYSTIN; BYSL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, BxPC-3, Jurkat, Mouse lung, Mouse testis, Rat lung, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BYSL (NP_004044.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HAEVVVDPEDERAIEMFMNKNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKAL | Uniprot ID | Q13895 |
Uniprot Id
Q13895
Target Species
Human
Target Name
BYSL
Target Full Name
Bystin
Target Function
Required for processing of 20S pre-rRNA precursor and biogenesis of 40S ribosomal subunits. May be required for trophinin-dependent regulation of cell adhesion during implantation of human embryos.
Target Subcellular Location
Cytoplasm. Nucleus, nucleolus. Note=Associated with 40S ribosomal subunits.
Target Protein Families
Bystin family
Target Tissue Specificity
Found in the placenta from the sixth week of pregnancy. Was localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the level decreased and then disappe
Target Synonyms
by the ribosomal protein s6 gene drosophila homolog like; BYSL; BYST_HUMAN; Bystin; bystin like
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
