-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against c-Maf was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against c-Maf was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04098A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | c-Maf |
| Target Synonyms | CCA4; AYGRP; c-MAF; CTRCT21; c-Maf | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, K-562, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK | Uniprot ID | O75444 |
Uniprot Id
O75444
Target Species
Human
Target Name
MAF
Target Full Name
Transcription factor Maf
Target Function
Acts as a transcriptional activator or repressor. Involved in embryonic lens fiber cell development. Recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. Activates the expression of IL4 in T helper 2 (Th2) cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression. Together with PAX6, transactivates strongly the glucagon gene promoter through the G1 element. Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction. Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. Binds to the sequence 5'-[GT]G[GC]N[GT]NCTCAGNN-3' in the L7 promoter. Binds to the T-MARE (Maf response element) sites of lens-specific alpha- and beta-crystallin gene promoters. Binds element G1 on the glucagon promoter. Binds an AT-rich region adjacent to the TGC motif (atypical Maf response element) in the CD13 proximal promoter in endothelial cells. When overexpressed, represses anti-oxidant response element (ARE)-mediated transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds to the ARE sites of detoxifying enzyme gene promoters.
Target Involvement
Cataract 21, multiple types (CTRCT21); Ayme-Gripp syndrome (AYGRP)
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Maf subfamily
Target Tissue Specificity
Expressed in endothelial cells.
Target Synonyms
AS42 oncogene homolog; Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene; Avian musculoaponeurotic fibrosarcoma (v maf) ; c maf proto oncogene; cMaf; maf; MAF_HUMAN; MAF2; MGC71685; Proto oncogene c Maf ; Proto-oncogene c-maf; Transcription factor Maf; v maf musculoaponeurotic fibrosarcoma oncogene homolog (avian); v maf musculoaponeurotic fibrosarcoma oncogene homolog; V-maf musculoaponeurotic fibrosarcoma oncogene homolog
Target Background
The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene.
Notification